Retrieve and Relate Wiki

Sample sequences

Sample sequences

This page is for the purpose of evaluating the results of BioStrand search page so that they exactly match the annotation provided for the particular sequence.

Note: This table is manually curated; some values may be old/need updates (for eg PDB ID may be expired, new name needs to be rewritten in that case OR PFAM ID may belong to another domain in the same chain by mistake, must be corrected)

Sr.No Protein_domain CATH PFAM SCOPE Sequence
1 4dfzE01 1.10.510.10 PF00069 aggemfshlrrigrfxepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwxlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvxinekcgkeftef
2 3dkaB01 1.20.120.450 PF05163 nqivshflshrnvtnelaekiskdhysykpaetsxsaeelvkhiltsfhlfanvi
kegnaspfqnkqeetetdlnvlaktytektvaileqlteeqldreidltsafgrkvtgra
llqlaxeheihhkgnlfvyvrexghtelpfy
3 2hjmA01 1.20.120.460 PF11505 vekvkelcleleeenlakaierfitlthgiektrgeafakasiygflegil
ttlkxkysnekietllnevktareeteallrkprppllvd
4 3v5xB00 1.20.120.520 PF01814 evdvftaphwrmkqlvglycdklsktnfsnnndfrallqslyatfkefkmheqi
eneyiigllqqrsqtiynvhsdnklsemlslfekglknvkneyeqlnyakqlkerleaft
rdflphmkeeeevfqpmlmeyftyeelkdikkkviaqhcs
5 3sxyB02 1.20.120.530 PF00392 dekfiretietrimmevfclenyfdkiagseelleikgeidd
veksakreifddsderlhklfirasgneliislyekiwdridlvrhlneryvvsnrehke
lieriisgdkegaieklkehlknveaetiknlytyers
6 3dbwA02 1.20.120.530 PF00392 dekfiretietrixxevfclenyfdkiagseell
eikgeiddvaasaareifddsderlhklfirasgneliislyekiwdridlvrhlneryv
vsnrehkelieriisgdkegaieklkehlknveaetiknlytyers
7 1e2xA02 1.20.120.530 PF00392 nnfwetsglniletlarldhesvpqlidnllsvrtnistifirta
frqhpdkaqevlatanevadhadafaeldynifrglafasgnpiyglilngmkglytrig
rhyfanpearslalgfyhklsalcsegahdqvyetvrryghesgeiwhrmqknlpgdl
8 1u8hA01 2.60.40.10 b.1.1.1 alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvrr
9 4dv1J00 3.30.70.600 PF00338 mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
ehfelrthnrlvdiinpnrktieqlmtldlptgveieik
10 4dv1J00 3.30.70.600 PF00338 mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
ehfelrthnrlvdiinpnrktieqlmtldlptgveieik
11 4dv1J00 3.30.70.600 PF00338 mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
ehfelrthnrlvdiinpnrktieqlmtldlptgveieik
12 2hruA03 3.30.1330.10 PF18072 aavmrikrdggyslvthsradlalqdtywgtl
iavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalknacefsgvpvasgnas
lyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfelerekelwrairklse
egafilsssqlltrthvetfreyglkievklpevrpahqmvlvfse
13 2zauA01 3.30.1330.10 PF00586 d.79.4.1 mkgfniytdestlvsigddagvyehngiiwvytvdiitpvvndpylwgaistanalsdvy
amggipvnalaiscfnnceldieifrevirgaldklreaktvllgghtiddkepkfglsv
agicpegkyit
14 3brsA02 3.40.50.2300 PF13407 c.93.1.0 niqagiri
gavtknlvrksgkigvisfvknsktamdreeglkiglsddsnkieaiyycdsnydkaydg
tvelltkypdisvmvglnqysatgaaraikdmsleakvklvcidssmeqiqyleegifea
mvvqk
15 3brsA02 3.40.50.2300 PF13407 l.1.1.1 nysigaelalqmva
dlggkgnvlvfngfysvpvckirydqmkyvleafpdvkiiepelrdvipntiqsaysnvt
dmltkypnegdvgaiwacwdvpmigatqalqaagrtdirtygvdgspefvemvadpespa
gavaaqq
16 3brsA02 3.40.50.2300 PF00990 qievlvvddsrtsrhrtxaqlrkqllqvheasharealatleqhpairlvlvdyyxp
eidgislvrxlreryskqqlaiigisvsdkrglsarylkqgandflnqpfepeelqcrvs
hnlealeqfnseghhhhhh
18 4rcgA03 3.90.228.20 PF00821 c.109.1.0 lgkkcyslriasamahdegwlaehmlilklispenkayyfaaafpsacgktnlam
lqptipgwraetlgddiawmrfgkdgrlyavnp
20 6ptiA00 4.10.410.10 PF00014 g.8.1.1 dfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg